Change channel
English
Supplier
Buyer
Help
Apps
Rules

Cosmetic Intermediate Soybean Extract Powder 10% Water Soluble Soy Isoflavones

$104.48

FOB Price:
Negotiable | Get Latest Price
Min.Order Quantity:
1 Set / Sets
Supply Ability:
1000 Set / Sets per Month
Port:
shanghai
Payment Terms:
T/T L/C D/P D/A Credit Card PayPal Cash Escrow Other
Delivery Detail:
5 days
Product Name: Cosmetic Intermediate Soybean Extract Powder 10% Water Soluble Soy Isoflavones Model NO.: Water Soluble Soy Isoflavones Type: Soy Isoflavones Extract Source: Germ Application: Food, Health Care Products, Medicine, Cosmetic Products Application Form: Injection, Lotion, Suppository, Paste, Tablet, Capsule, Cream Assay Method: HPLC Certification: RoHS, BRC, ISO, FDA, HACCP Product Name: Soy Isoflavones Other Name: Isoflavone CAS: 574-12-9 Mf: C15h10o2 Extraction Type: Solvent Extraction Grade: Cosmetic Grade, Medical Grade MOQ: 100g Sample: Support Storage Conditions: Store in a Dry and Dark Place, Sealed Shelf Life: 2 Years Key Words: Phytoestrogen Trademark: HonGKANGBIO Transport Package: Aluminum Foil Bag Packaging Specification: 10% Origin: China HS Code: 2914399090 Product Description Cosmetic Intermediate Soybean Extract Powder 10% Water Soluble Soy IsoflavonesProduct NameWater Soluble Soy IsoflavonesSpecification10%AppearanceWhite PowderCAS No.574-12-9Molecular FormulaC15H10O2Molecular weight222.24MOQ1kgStorage conditionKeep in a cool, dry, dark location in a tightly sealed container or cylinder. Keep away from incompatible materials, ignitionsources and untrained individuals. Secure and label area. Protect containers/cylinders from physical damage.Shelf Life24 monthsWhat is soy isoflavones?Soy isoflavones belong to a class of plant-based compounds known as phytoestrogens, so-called becausethey are similar in chemical structure and function to the female sex hormone estrogen. Soy isoflavones occurnaturally in soybeans and can be found in several soy-based foods such as miso, soy sauce, tofu, edamame,soy milk and soy butter. Researchers have found that these compounds have some medicinal properties,particularly for women, and continue to study soy isoflavones for other health benefitsSoybean Extract Soy isoflavone Powder has many uses and was not originally used as a food product but forpaper coatings used as a pigment binder. Today, soy is used in many foods and other products as well.After continuous efforts, the research and development team of Shaanxi Hongkangbio has successfullydeveloped water-soluble soy isoflavones, which solves the problem that ordinary soy isoflavones aredifficult to be absorbed by the human body and their use limitations.Sample displayWater Soluble Soy isoflavones 10% presents white powderBelow are some samples of this product.The picture may have minor changes due to lighting issues and actuality, but we can guarantee that the productis absolutely true and effective.Main Functions:1. Natural antioxidantsRecent studies indicate that isoflavones have beneficial antioxidant properties similar to that of vitamin E. Theseantioxidant properties assist in reducing long-term cancer risk through guarding against free radical damage.2. Lowers bad cholesterolThe isoflavones found in vegetables and fruits are micronutrients required by the body for maintaining a healthyheart. It reduces the blood cholesterol level as well as the risk of developing heart complications. Isoflavones stopthe cell growth that leads to artery clogging. If these arteries clog, it can easily lead to strokes or heart attacks.3. Reduces symptoms of menopauseSoy isoflavones have been found to reduce certain symptoms of menopause like increased bone density and hotflushes in women. In fact, many post-menopausal and menopausal health complications usually result from theabsence of isoflavones in people's regular diets. Research shows that prescribed supplements were based mainlyon soy plant, hops and black cohosh4. Guards against prostrate complicationsIsoflavones are highly useful when it comes to men's health as they guard against the enlargement of the prostategland. They slow down advancement of prostate cancer through causing the elimination of prostate cancer cells.The isoflavones act against the cancer cells in a similar manner to other cancer treating medications.5. Enhances bone healthIsoflavones assist in bone preservation as well as fighting osteoporosis. Unlike estrogen that only assists inpreventing bone destruction, isoflavones aid in the creation of new bones. Other studies show that the isoflavonesprevent skeletal disease and osteoporosis as well.Applications:1.Applied in bio-pesticide. It can be used to produce bio-pesticide of high-effective, low toxicity and low residue.2.Applied in medical area. It can be used to treat Alzheimer.3.Applied in smoke quitting. It can be used to made e-juice, nicotine patches and other smoke quitting products4.Used as an additive to manufacture food, nutrition and health care products, flavors and fragrances, cosmetics,and animal feeds.5.Used in Nicotine replacement therapy. High purity can help smoker quit smoking and also can preventnon-smoker antist smoking.Recommended transportation selectionsBy ExpressBy Air TransportationBy Sea TransportationSuitable for sample order or <50kgFast: 3-10 daysHigh shipping costDoor to door serviceSuitable for >50kgFast: 3-7 daysLower than express costAirport to airport serviceProfessional broker neededSuitable for > 300kgSlow: 7-45 daysLowest costPort to port serviceProfessional broker neededShaanxiHongkangBiologicalTechnologyCo.,Ltdwasfoundedin2010,professionalcommittedtothenaturalplantactiveingredientresearch,development,productionandsales,withownimportandexportrights.Widelyusedincosmetics,healthproducts,foodadditivesandotherindustries.ShaanxiHongkangwillcontinuouslytofocusonandservehumanhealthfromaglobalperspective,andcreatehigh-qualityproductsinthefieldofgreenhealth.Afteryearsofcontinuousdevelopment,companyhasbeenaccumulatedrichexperienceininternationaltradeandcustomerresources,establishedastablecustomerbaseandperfectmarketingservicenetwork.Companyhasperfectqualityassurancesystem,implementstrictqualitycontrolstandards.ThequalitymanagementdepartmentisequippedwithanumberofsetsofUV,GC,HPLC,GC-MSandotheradvancedtestingandexperimentalinstruments.Besides,ithasadetaileddivisionoflaborforthethreefunctionsofprocessresearch,qualityassuranceandqualityinspection,whichcaneffectivelyandcomprehensivelycontrolthequalityoftheproductionprocess,conductcomprehensiveinspectionandanalysisonthefinalproduct,andensurethequalityoftheproduct.Providinguserswithsatisfactoryproductsisourconstantpursuit.thecompanyhasseveralplantextractionproductionlinesintheworkshop,AndsupercriticalCO2extraction,columnseparationtechnology,membraneseparationtechnology,high-efficiencycountercurrentextraction,microwavedryingtechnology,spraydryingandotheradvancedproductionequipment,andhasformedanannualoutputof200tonsofhigh-purityplantextractsproductioncapacity,Completeproductspecificationsandstablequality.WiththecertificateofISO9001:14001:45001.Q1:Howto/confirm/itheProductQualitybeforeplacingorders?A:Bysendingyououravailablesamples.Orifyouhavespecialrequirementonthegoods,wecanpreparesamplesaccordingtoyourrequirementandsendtoyouforyour/confirm/iation.Q2:Canyousupplyfreesamples?A:Yes,wecanprovidesomefreesample,buttheshippingcostshouldbeonthecustomers'account.Youcaneitherpayustheshippingcostorarrangeacouriertocollectthesamples.Q3:What'stheMOQ?A:Forthehighvalueproduct,ourMOQstartsfrom1gandgenerallystartsfrom10g.Forotherlowvalueproduct,ourMOQstartsfrom100gand1kg.Q4:Isthereanydiscount?A:Yes,forlargerquantity,wealwayssupportwithbetterprice.Q5:Howtoplaceorderandmakepayment?A:YoucansendouryourPurchaseorder(ifyourcompanyhas),orjustsendasimple/confirm/iationbyemailorbyTradeManager,andwewillsendyouProformaInvoicewithourbankdetailsforyour/confirm/iation.,thenyoucanmakepaymentaccordingly.Q6:Howdoyoutreatqualitycomplaint?A:AllourproductsarestrictlytestedbyourQC,and/confirm/iedbyQA;unqualifiedmaterialwillnotbereleasedtocustomer.Incaseanyqualityproblemis/confirm/iedtobecausedbyus,wewillreplacethegoodsorrefundyourpaymentimmediately.Howtoorder?1.MakesureyourquantityneedandLeaveusmessage,withyourmaileddetailsshown:Includingcontactname, addressinformation,contactphone,etc.2.WesendyouaPI(ProformaInvoice)forpriceandpaymentdetail.3.PaymentbyPaypalorWesternUnionorT/T.4.Wearrangethedeliveryandupdateyouthetrackingnumberintime.Why Choose Us?High speed trasportation:1 day for prepare goods. door to door.Free samples:1-2 free samples. Purchaser only needs to pay express fee.Manufacturer:The most direct price. The most stringent produce control.Safe Packaging:Double safeguard(rubber gasket, high viscosity glue) to keep bottle seal.High quality:Could stand the specified test.
Contact with Supplier
* Title
* Content
Company
* Name
* Telephone
*Email
QQ
Ali IM
* Question
* Captcha  
   Available today 30 times    Currently sent times    Available send times
Product Categories for this supplier
  • none

Cosmetic Intermediate Soybean Extract Powder 10% Water Soluble Soy Isoflavones

Quantity
10000 Piece
Products Cost
$104.48
Area
Chinashannxixian
Shaanxi Hongkang Biological Technology Co., Ltd.
Chinashannxixian 1Years

Response Rate: High

Avg Response Time: 24–48 h

Business Type: